BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase Chk1
LigandBDBM50221589
Substrate/Competitorn/a
Meas. Tech.Abbott Kinase Enzymatics_CHK1/289 CDC25c
IC50 5±n/a nM
Citation CSARdock CD CHK1 in CSAR_FULL_RELEASE_3JULY2012 CSAR 1:0 (2012)    Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Serine/threonine-protein kinase Chk1
Name:Serine/threonine-protein kinase Chk1
Synonyms:CHK1 checkpoint homolog | Checkpoint kinase-1 (CHK1) | Serine/threonine-protein kinase Chk1
Type:Enzyme Catalytic Domain
Mol. Mass.:54443.02
Organism:Homo sapiens
Description:gi_166295192
Residue:476
Sequence:
MAVPFVEDWDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRAVDCPENIKKEICINK
MLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFHQLMAGVVY
LHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLK
RREFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLA
LLHKILVENPSARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDF
SPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCPDHMLLNSQLL
GTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQWKKSCMNQVTISTTDRR
NNKLIFKVNLLEMDDKILVDFRLSKGDGLEFKRHFLKIKGKLIDIVSSQKIWLPAT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50221589
NameBDBM50221589
Synonyms:4-((6,7-dimethoxy-1,4-dihydroindeno[1,2-c]pyrazol-3-yl)ethynyl)-2-methoxyphenol | 4-(6,7-dimethoxy-2,4-dihydro-indeno[1,2-c]pyrazol-3-ylethynyl)-2-methoxy-phenol | CHEMBL248396 | Chk1_146
TypeSmall organic molecule
Emp. Form.C21H18N2O4
Mol. Mass.362.3786
SMILESCOc1cc2Cc3c(n[nH]c3C#Cc3ccc(O)c(OC)c3)-c2cc1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a