Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLactate dehydrogenase A (LDHA)
LigandBDBM23222
Substrate/Competitorn/a
Meas. Tech.ChEMBL_959391
IC50 57200±n/a nM
Citation Dragovich PSFauber BPCorson LBDing CZEigenbrot CGe HGiannetti AMHunsaker TLabadie SLiu YMalek SPan BPeterson DPitts KPurkey HESideris SUltsch MVanderPorten EWei BXu QYen IYue QZhang HZhang X Identification of substituted 2-thio-6-oxo-1,6-dihydropyrimidines as inhibitors of human lactate dehydrogenase. Bioorg Med Chem Lett 23:3186-94 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lactate dehydrogenase A (LDHA)
Name:L-lactate dehydrogenase A chain
Synonyms:Cell proliferation-inducing gene 19 protein | L-lactate dehydrogenase A | L-lactate dehydrogenase A Chain | LDH muscle subunit | LDH-A | LDH-M | Renal carcinoma antigen NY-REN-59
Type:Protein
Mol. Mass.:36694.85
Organism:Homo sapiens (Human)
Description:P00338::PDB Code: 4ajp
Residue:332
Sequence:
MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKG
EMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFI
IPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGV
HPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYE
VIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGI
SDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM23222
NameBDBM23222
Synonyms:Oxalamic acid | Oxamate | Oxamate, 3 | Oxamidic Acid | carbamoylformic acid
TypeSmall organic molecule
Emp. Form.C2H3NO3
Mol. Mass.89.0501
SMILESNC(=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a