Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
LigandBDBM50365476
Substrate/Competitorn/a
Meas. Tech.ChEMBL_943441
IC50 12±n/a nM
Citation Geschwindner SDekker NHorsefield RTigerström AJohansson PScott CWAlbert JS Development of a plate-based optical biosensor fragment screening methodology to identify phosphodiesterase 10A inhibitors. J Med Chem 56:3228-34 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
Name:cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
Synonyms:PDE10A | Phosphodiesterase 10 (PDE10) | Phosphodiesterase 10A
Type:Protein
Mol. Mass.:88412.52
Organism:Homo sapiens (Human)
Description:Q9Y233
Residue:779
Sequence:
MRIEERKSQHLTGLTDEKVKAYLSLHPQVLDEFVSESVSAETVEKWLKRKNNKSEDESAP
KEVSRYQDTNMQGVVYELNSYIEQRLDTGGDNQLLLYELSSIIKIATKADGFALYFLGEC
NNSLCIFTPPGIKEGKPRLIPAGPITQGTTVSAYVAKSRKTLLVEDILGDERFPRGTGLE
SGTRIQSVLCLPIVTAIGDLIGILELYRHWGKEAFCLSHQEVATANLAWASVAIHQVQVC
RGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHKNKELY
SDLFDIGEEKEGKPVFKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREVDLYT
GYTTRNILCMPIVSRGSVIGVVQMVNKISGSAFSKTDENNFKMFAVFCALALHCANMYHR
IRHSECIYRVTMEKLSYHSICTSEEWQGLMQFTLPVRLCKEIELFHFDIGPFENMWPGIF
VYMVHRSCGTSCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNNHTLFTD
LERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLEGHNI
FSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLNNQSHRDRVIGLMM
TACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKKDEVPQGQLGFY
NAVAIPCYTTLTQILPPTEPLLKACRDNLSQWEKVIRGEETATWISSPSVAQKAAASED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50365476
n/a
NameBDBM50365476
Synonyms:CHEMBL1957361
TypeSmall organic molecule
Emp. Form.C23H17N3O2
Mol. Mass.367.4
SMILESCCOc1ccccc1-c1ccc(cc1)-c1nc2ccncc2c(O)c1C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: