BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLiver fatty acid binding protein (human L-FABP T94T)
LigandBDBM50150484
Substrate/Competitorn/a
Meas. Tech.ChEMBL_555399
Kd 200±n/a nM
Citation Chuang SVelkov THorne JPorter CJScanlon MJ Characterization of the drug binding specificity of rat liver fatty acid binding protein. J Med Chem 51:3755-64 (2008) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Liver fatty acid binding protein (human L-FABP T94T)
Name:Liver fatty acid binding protein (human L-FABP T94T)
Synonyms:FABP1 | Fatty acid-binding protein, liver
Type:Protein
Mol. Mass.:14208.72
Organism:Homo sapiens (Human)
Description:human L-FABP
Residue:127
Sequence:
MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQ
NEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVF
KRISKRI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50150484
n/a
NameBDBM50150484
Synonyms:(Z)-9-octadecenoic acid | (Z)-Octadec-9-enoic acid | CHEMBL8659 | OLEATE | Octadec-9-enoic acid | oleaic acid | oleicacid
TypeSmall organic molecule
Emp. Form.C18H34O2
Mol. Mass.282.4614
SMILESCCCCCCCC\C=C/CCCCCCCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: