Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCollagenase
LigandBDBM50096463
Substrate/Competitorn/a
Meas. Tech.ChEMBL_106467
IC50 8±n/a nM
Citation Levin JIDu MTDiJoseph JFKillar LMSung AWalter TSharr MARoth CEMoy FJPowers RJin GCowling RSkotnicki JS The discovery of anthranilic acid-based MMP inhibitors. Part 1: SAR of the 3-position. Bioorg Med Chem Lett 11:235-8 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Collagenase
Name:Collagenase
Synonyms:Collagenase 3 | MMP-13 | Matrix metalloproteinase-13 | Matrix metalloproteinase-13 (MMP-13) | Matrix metalloproteinase-13 (MMP13)
Type:Enzyme
Mol. Mass.:53808.06
Organism:Homo sapiens (human)
Description:n/a
Residue:471
Sequence:
MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENA
ASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTY
RIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDG
PSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALM
FPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGET
MIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGY
DILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLI
EEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50096463
NameBDBM50096463
Synonyms:CHEMBL70176 | N-Hydroxy-2-[(4-methoxy-benzenesulfonyl)-pyridin-3-ylmethyl-amino]-3-methyl-benzamide | N-hydroxy-2-(4-methoxy-N-(pyridin-3-ylmethyl)phenylsulfonamido)-3-methylbenzamide
TypeSmall organic molecule
Emp. Form.C21H21N3O5S
Mol. Mass.427.474
SMILESCOc1ccc(cc1)S(=O)(=O)N(Cc1cccnc1)c1c(C)cccc1C(=O)NO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a