BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCDC7/DBF4 (Cell division cycle 7-related protein kinase/Activator of S phase kinase)
LigandBDBM50361088
Substrate/Competitorn/a
Meas. Tech.ChEMBL_795081
IC50>10000±n/a nM
Citation Caruso MValsasina BBallinari DBertrand JBrasca MGCaldarelli MCappella PFiorentini FGianellini LMScolaro ABeria I 5-(2-amino-pyrimidin-4-yl)-1H-pyrrole and 2-(2-amino-pyrimidin-4-yl)-1,5,6,7-tetrahydro-pyrrolo[3,2-c]pyridin-4-one derivatives as new classes of selective and orally available Polo-like kinase 1 inhibitors. Bioorg Med Chem Lett 22:96-101 (2011) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
CDC7/DBF4 (Cell division cycle 7-related protein kinase/Activator of S phase kinase)
Name:Cell division cycle 7-related protein kinase
Synonyms:Cell division cycle 7-related protein kinase | Cell division cycle 7-related protein kinase (CDC7)
Type:Protein
Mol. Mass.:63908.16
Organism:Homo sapiens (Human)
Description:O00311
Residue:574
Sequence:
MEASLGIQMDEPMAFSPQRDRFQAEGSLKKNEQNFKLAGVKKDIEKLYEAVPQLSNVFKI
EDKIGEGTFSSVYLATAQLQVGPEEKIALKHLIPTSHPIRIAAELQCLTVAGGQDNVMGV
KYCFRKNDHVVIAMPYLEHESFLDILNSLSFQEVREYMLNLFKALKRIHQFGIVHRDVKP
SNFLYNRRLKKYALVDFGLAQGTHDTKIELLKFVQSEAQQERCSQNKSHIITGNKIPLSG
PVPKELDQQSTTKASVKRPYTNAQIQIKQGKDGKEGSVGLSVQRSVFGERNFNIHSSISH
ESPAVKLMKQSKTVDVLSRKLATKKKAISTKVMNSAVMRKTASSCPASLTCDCYATDKVC
SICLSRRQQVAPRAGTPGFRAPEVLTKCPNQTTAIDMWSAGVIFLSLLSGRYPFYKASDD
LTALAQIMTIRGSRETIQAAKTFGKSILCSKEVPAQDLRKLCERLRGMDSSTPKLTSDIQ
GHASHQPAISEKTDHKASCLVQTPPGQYSGNSFKKGDSNSCEHCFDEYNTNLEGWNEVPD
EAYDLLDKLLDLNPASRITAEEALLHPFFKDMSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50361088
n/a
NameBDBM50361088
Synonyms:CHEMBL1933582
TypeSmall organic molecule
Emp. Form.C24H26F3N7O2
Mol. Mass.501.5041
SMILESCN1CCN(CC1)c1ccc(OC(F)(F)F)c(Nc2nccc(n2)-c2cc3c(CCNC3=O)n2C)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: