Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase Nek2
LigandBDBM50339801
Substrate/Competitorn/a
Meas. Tech.ChEMBL_735640
IC50 360±n/a nM
Citation Solanki SInnocenti PMas-Droux CBoxall KBarillari Cvan Montfort RLAherne GWBayliss RHoelder S Benzimidazole inhibitors induce a DFG-out conformation of never in mitosis gene A-related kinase 2 (Nek2) without binding to the back pocket and reveal a nonlinear structure-activity relationship. J Med Chem 54:1626-39 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase Nek2
Name:Serine/threonine-protein kinase Nek2
Synonyms:NEK2
Type:Enzyme
Mol. Mass.:51776.96
Organism:Homo sapiens (Human)
Description:P51955
Residue:445
Sequence:
MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLR
ELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQL
TLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKTFVGTP
YYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRY
SDELNEIITRMLNLKDYHRPSVEEILENPLIADLVADEQRRNLERRGRQLGEPEKSQDSS
PVLSELKLKEIQLQERERALKAREERLEQKEQELCVRERLAEDKLARAENLLKNYSLLKE
RKFLSLASNPELLNLPSSVIKKKVHFSGESKENIMRSENSESQLTSKSKCKDLKKRLHAA
QLRAQALSDIEKNYQLKSRQILGMR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50339801
n/a
NameBDBM50339801
Synonyms:(R)-4-(5-(1-Methylpiperidin-4-yloxy)-1H-benzo[d]imidazol-1-yl)-2-(1-(2-(trifluoromethyl)phenyl)ethoxy)benzamide | 4-{5-[(1-METHYLPIPERIDIN-4-YL)OXY]-1H-BENZIMIDAZOL-1-YL}-2-{(1R)-1-[2-(TRIFLUOROMETHYL)PHENYL]ETHOXY}BENZAMIDE | CHEMBL1615277
TypeSmall organic molecule
Emp. Form.C29H29F3N4O3
Mol. Mass.538.5608
SMILESC[C@@H](Oc1cc(ccc1C(N)=O)-n1cnc2cc(OC3CCN(C)CC3)ccc12)c1ccccc1C(F)(F)F |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: