Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase PIM
LigandBDBM26673
Substrate/Competitorn/a
Meas. Tech.ChEMBL_588650
IC50 50±n/a nM
Citation Abadi AHAbouel-Ella DALehmann JTinsley HNGary BDPiazza GAAbdel-Fattah MA Discovery of colon tumor cell growth inhibitory agents through a combinatorial approach. Eur J Med Chem 45:90-7 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase PIM
Name:Serine/threonine-protein kinase PIM
Synonyms:PIM-1 Kinase | PIM1 | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase pim-1 | Serine/threonine-protein kinase pim-1 (PIM1)
Type:Protein
Mol. Mass.:45417.87
Organism:Homo sapiens (Human)
Description:P11309
Residue:404
Sequence:
MPHEPHEPLTPPFSALPDPAGAPSRRQSRQRPQLSSDSPSAFRASRSHSRNATRSHSHSH
SPRHSLRHSPGSGSCGSSSGHRPCADILEVGMLLSKINSLAHLRAAPCNDLHATKLAPGK
EKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPME
VVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFW
QVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSP
PEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIRGQVFFRQRVSSECQHLIRW
CLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26673
NameBDBM26673
Synonyms:6-(5-bromo-2-hydroxyphenyl)-2-oxo-4-phenyl-1,2-dihydropyridine-3-carbonitrile | CHEMBL391586 | pyridone-based compound, 1
TypeSmall organic molecule
Emp. Form.C18H11BrN2O2
Mol. Mass.367.196
SMILESOc1ccc(Br)cc1-c1cc(-c2ccccc2)c(C#N)c(=O)[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a