Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRXR alpha/PPAR gamma
LigandBDBM50032675
Substrate/Competitorn/a
Meas. Tech.ChEMBL_589774
Ki 21±n/a nM
Citation Wagner CEJurutka PWMarshall PAGroy TLvan der Vaart AZiller JWFurmick JKGraeber MEMatro EMiguel BVTran ITKwon JTedeschi JNMoosavi SDanishyar APhilp JSKhamees ROJackson JNGrupe DKBadshah SLHart JW Modeling, synthesis and biological evaluation of potential retinoid X receptor (RXR) selective agonists: novel analogues of 4-[1-(3,5,5,8,8-pentamethyl-5,6,7,8-tetrahydro-2-naphthyl)ethynyl]benzoic acid (bexarotene). J Med Chem 52:5950-66 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
RXR alpha/PPAR gamma
Name:Retinoic acid receptor alpha/Retinoid X receptor alpha
Synonyms:Nuclear receptor subfamily 2 group B member 1 | Retinoic acid receptor RXR-alpha | Retinoid X receptor alpha | Retinoid X receptor alpha (F313A) | Retinoid X receptor alpha (F313I) | Retinoid X receptor alpha (F313S) | Retinoid X receptor alpha (L436F) | Retinoid X receptor alpha (L436V) | Retinoid receptor
Type:PROTEIN
Mol. Mass.:50820.38
Organism:Homo sapiens
Description:ChEMBL_1456363
Residue:462
Sequence:
MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPING
MGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVP
AHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLID
KRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAEL
AVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVIL
LRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDM
QMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLL
RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50032675
n/a
NameBDBM50032675
Synonyms:4-[1-(3,5,5,8,8-pentamethyl-5,6,7,8-tetrahydronaphthalen-2-yl)vinyl]benzoic acid | BEXAROTENE | CHEMBL1023 | p-(1-(5,6,7,8-Tetrahydro-3,5,5,8,8-pentamethyl-2-naphthyl)vinyl)benzoic acid
TypeSmall organic molecule
Emp. Form.C24H28O2
Mol. Mass.348.4779
SMILESCc1cc2c(cc1C(=C)c1ccc(cc1)C(O)=O)C(C)(C)CCC2(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: