BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinoid X receptor beta
LigandBDBM50032675
Substrate/Competitorn/a
Meas. Tech.ChEMBL_197071
Ki 21±n/a nM
Citation Farmer LJJeong SKallel EAKoch SSCroston GEFlatten KSHeyman RANadzan AM Synthesis and structure-activity relationships of potent retinoid X receptor ligands Bioorg Med Chem Lett 7:2393-2398 (1997)    Article
More Info.:Get all data from this article,  Assay Method
 
Retinoid X receptor beta
Name:Retinoid X receptor beta
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:55877.78
Organism:Mus musculus
Description:ChEMBL_196588
Residue:520
Sequence:
MSWATRPPFLPPRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAGEQQALEP
EPGEAGRDGMGDSGRDSRSPDSSSPNPLSQGIRPSSPPGPPLTPSAPPPPMPPPPLGSPF
PVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPP
PPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSCRDNKDCTVDKRQ
RNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGDGAGGAPEEMPVDRILEAELAVEQ
KSDQGVEGPGATGGGGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSSLPLDDQVILLR
AGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMRM
DKTELGCLRAIILFNPDAKGLSNPGEVEILREKVYASLETYCKQKYPEQQGRFAKLLLRL
PALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50032675
n/a
NameBDBM50032675
Synonyms:4-[1-(3,5,5,8,8-pentamethyl-5,6,7,8-tetrahydronaphthalen-2-yl)vinyl]benzoic acid | BEXAROTENE | CHEMBL1023 | p-(1-(5,6,7,8-Tetrahydro-3,5,5,8,8-pentamethyl-2-naphthyl)vinyl)benzoic acid
TypeSmall organic molecule
Emp. Form.C24H28O2
Mol. Mass.348.4779
SMILESCc1cc2c(cc1C(=C)c1ccc(cc1)C(O)=O)C(C)(C)CCC2(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: