Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinoid X receptor gamma/retinoic acid receptor alpha
LigandBDBM50032675
Substrate/Competitorn/a
Meas. Tech.ChEMBL_197240
Ki 29±n/a nM
Citation Canan Koch SSDardashti LJCesario RMCroston GEBoehm MFHeyman RANadzan AM Synthesis of retinoid X receptor-specific ligands that are potent inducers of adipogenesis in 3T3-L1 cells. J Med Chem 42:742-50 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Retinoid X receptor gamma/retinoic acid receptor alpha
Name:Retinoid X receptor gamma/retinoic acid receptor alpha
Synonyms:Nuclear receptor subfamily 2 group B member 3 | Retinoic acid receptor RXR-gamma | Retinoid X receptor gamma
Type:PROTEIN
Mol. Mass.:50878.26
Organism:Homo sapiens
Description:ChEMBL_197216
Residue:463
Sequence:
MYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVG
TPLNALGSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLPGLPG
IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECATSGHEDMPVERIL
EAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50032675
n/a
NameBDBM50032675
Synonyms:4-[1-(3,5,5,8,8-pentamethyl-5,6,7,8-tetrahydronaphthalen-2-yl)vinyl]benzoic acid | BEXAROTENE | CHEMBL1023 | p-(1-(5,6,7,8-Tetrahydro-3,5,5,8,8-pentamethyl-2-naphthyl)vinyl)benzoic acid
TypeSmall organic molecule
Emp. Form.C24H28O2
Mol. Mass.348.4779
SMILESCc1cc2c(cc1C(=C)c1ccc(cc1)C(O)=O)C(C)(C)CCC2(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: