Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlcohol dehydrogenase
LigandBDBM50064266
Substrate/Competitorn/a
Meas. Tech.ChEMBL_31170
Ki 12000±n/a nM
Citation Schindler JFBerst KBPlapp BV Inhibition of human alcohol dehydrogenases by formamides. J Med Chem 41:1696-701 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alcohol dehydrogenase
Name:Alcohol dehydrogenase
Synonyms:Alcohol dehydrogenase gamma chain
Type:PROTEIN
Mol. Mass.:39877.25
Organism:Homo sapiens
Description:ChEMBL_31170
Residue:375
Sequence:
MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAAGICRSDEHVVSGNLVT
PLPVILGHEAAGIVESVGEGVTTVKPGDKVIPLFTPQCGKCRICKNPESNYCLKNDLGNP
RGTLQDGTRRFTCSGKPIHHFVGVSTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTG
YGSAVKVAKVTPGSTCAVFGLGGVGLSVVMGCKAAGAARIIAVDINKDKFAKAKELGATE
CINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPDSQ
NLSINPMLLLTGRTWKGAIFGGFKSKESVPKLVADFMAKKFSLDALITNILPFEKINEGF
DLLRSGKSIRTVLTF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50064266
n/a
NameBDBM50064266
Synonyms:CHEMBL43719 | HEPTYLFORMAMIDE | N-Heptyl-formamide
TypeSmall organic molecule
Emp. Form.C8H17NO
Mol. Mass.143.2267
SMILESCCCCCCCNC=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: