Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetChitinase
LigandBDBM81343
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
pH5.5±0
IC50 1.000e+6± 1.00e+5 nM
Citation Andersen OANathubhai ADixon MJEggleston IMvan Aalten DM Structure-based dissection of the natural product cyclopentapeptide chitinase inhibitor argifin. Chem Biol 15:295-301 (2008) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Chitinase
Name:Chitinase
Synonyms:Chitinase-1 | Chitotriosidase | Chitotriosidase-1 | Chitotriosidase-1 (CHIT1)
Type:Enzyme
Mol. Mass.:51682.25
Organism:Homo sapiens (human)
Description:CHIT1_HUMAN Q13231
Residue:466
Sequence:
MVRSVAWAGFMVLLMIPWGSAAKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAG
MTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFV
NSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLL
SAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAAS
LNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGM
LAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWAL
DLDDFAGFSCNQGRYPLIQTLRQELSLPYLPSGTPELEVPKPGQPSEPEHGPSPGQDTFC
QGKADGLYPNPRERSSFYSCAAGRLFQQSCPTGLVFSNSCKCCTWN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81343
NameBDBM81343
Synonyms:Monopeptide
TypeSmall organic molecule
Emp. Form.C11H22N6O3
Mol. Mass.286.3308
SMILESCNC(=O)NC(N)=NCCC[C@H](NC(C)=O)C(=O)NC |r,w:7.7|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a