Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHIV-1 Reverse Transcriptase Mutant (Y181C)
LigandBDBM1944
Substrate/Competitorpoly(rA)600:oligo(dT)10
Meas. Tech.HIV-1 RT Assay
IC50 8320±n/a nM
Citation Romero DLOlmsted RAPoel TJMorge RABiles CKeiser BJKopta LAFriis JMHosley JDStefanski KJWishka DGEvans DBMorris JStehle RGSharma SKYagi YVoorman RLAdams WJTarpley WGThomas RC Targeting delavirdine/atevirdine resistant HIV-1: identification of (alkylamino)piperidine-containing bis(heteroaryl)piperazines as broad spectrum HIV-1 reverse transcriptase inhibitors. J Med Chem 39:3769-89 (1996) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
HIV-1 Reverse Transcriptase Mutant (Y181C)
Name:HIV-1 Reverse Transcriptase Mutant (Y181C)
Synonyms:EC: 2.7.7.49
Type:Protein Complex
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:HIV-1 Reverse Transcriptase Mutant (Y181C) Chain A
Synonyms:n/a
Type:Enzyme Subunit
Mol. Mass.:64323.24
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:559
Sequence:
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAEL
ELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAH
TNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPP
LVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQA
IYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKG
IGGNEQVDKLVSAGIRKVL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:HIV-1 Reverse Transcriptase Mutant (Y181C) Chain B
Synonyms:n/a
Type:Enzyme Subunit
Mol. Mass.:51277.10
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:440
Sequence:
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM1944
poly(rA)600:oligo(dT)10
Name:poly(rA)600:oligo(dT)10
Synonyms:n/a
Type:RNA-DNA duplex
Mol. Mass.:358.43
Organism:n/a
Description:The incorporation of thymidine triphosphate with [methyl-3H]thymidine 5 -triphosphate onto a poly(rA)600:oligo(dT)10 template:primer.
Residue:3
Sequence:
n/a