Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFarnesyl diphosphate synthase
LigandBDBM36501
Substrate/CompetitorBDBM36499
Meas. Tech.Biophysical assay
pH7.4±0
Temperature296.15±0 K
IC50>5.00e+5± 0 nM
Citation Jahnke WRondeau JMCotesta SMarzinzik APellé XGeiser MStrauss AGötte MBitsch FHemmig RHenry CLehmann SGlickman JFRoddy TPStout SJGreen JR Allosteric non-bisphosphonate FPPS inhibitors identified by fragment-based discovery. Nat Chem Biol 6:660-6 (2010) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Farnesyl diphosphate synthase
Name:Farnesyl diphosphate synthase
Synonyms:Dimethylallyltranstransferase | FPP synthase | FPP synthetase | FPS | Farnesyl diphosphate synthase (FPPS) | Farnesyl diphosphate synthetase | Farnesyl pyrophosphate synthase (FPPS) | Farnesyl pyrophosphate synthetase | Geranyltranstransferase | P14324
Type:Enzyme
Mol. Mass.:48272.89
Organism:Homo sapiens (Human)
Description:P14324
Residue:419
Sequence:
MPLSRWLRSVGVFLLPAPYWAPRERWLGSLRRPSLVHGYPVLAWHSARCWCQAWTEEPRA
LCSSLRMNGDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAI
GGKYNRGLTVVVAFRELVEPRKQDADSLQRAWTVGWCVELLQAFFLVADDIMDSSLTRRG
QICWYQKPGVGLDAINDANLLEACIYRLLKLYCREQPYYLNLIELFLQSSYQTEIGQTLD
LLTAPQGNVDLVRFTEKRYKSIVKYKTAFYSFYLPIAAAMYMAGIDGEKEHANAKKILLE
MGEFFQIQDDYLDLFGDPSVTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKE
AEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM36501
NameBDBM36501
Synonyms:2-(5-chloro-3-methylbenzo[b]thiophen-2-yl)acetic acid, 2 | CID68686
TypeSmall organic molecule
Emp. Form.C11H9ClO2S
Mol. Mass.240.706
SMILESCc1c(CC(O)=O)sc2ccc(Cl)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM36499
NameBDBM36499
Synonyms:DMAPP | Dimethylallyl pyrophosphate
TypeSubstrate
Emp. Form.C5H9O6P2
Mol. Mass.227.0705
SMILES[#6]\[#6](-[#6])=[#6]\[#6]-[#8]P([#8-])(=O)P([#8-])([#8-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: