Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-mannosidase
LigandBDBM36385
Substrate/Competitorn/a
Meas. Tech.Btman2A
pH5.6±0
Temperature310.15±0 K
Ki 1.1e+4± 0 nM
Citation Tailford LEOffen WASmith NLDumon CMorland CGratien JHeck MPStick RVBlériot YVasella AGilbert HJDavies GJ Structural and biochemical evidence for a boat-like transition state in beta-mannosidases. Nat Chem Biol 4:306-12 (2008) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Beta-mannosidase
Name:Beta-mannosidase
Synonyms:n/a
Type:Protien
Mol. Mass.:99501.54
Organism:Bacteroides thetaiotaomicron
Description:Q8AAK6
Residue:864
Sequence:
MILNLTGKIAPIACGLLCCCSMVYAQGNDTSEVMLLDTGWEFSQSGTEKWMPATVPGTVH
QDLISHELLPNPFYGMNEKKIQWVENEDWEYRTSFIVSEEQLNRDGIQLIFEGLDTYADV
YLNGSLLLKADNMFVGYTLPVKSVLRKGENHLYIYFHSPIRQTLPQYASNGFNYPADNDH
HEKHLSVFSRKAPYSYGWDWGIRMVTSGVWRPVTLRFYDIATISDYYVRQLSLTDENARL
SNELIVNQIVPQKIPAEVRVNVSLNGTTVTEVKQQVTLQPGINHITLPAEVTNPVRWMPN
GWGTPTLYDFSAQIACGDRIVAEQSHRIGLRTIRVVNEKDKDGESFYFEVNGIPMFAKGA
NYIPQDALLPNVTTERYQTLFRDMKEANMNMVRIWGGGTYENNLFYDLADENGILVWQDF
MFACTPYPSDPTFLKRVEAEAVYNIRRLRNHASLAMWCGNNEILEALKYWGFEKKFTPEV
YQGLMHGYDKLFRELLPSTVKEFDSDRFYVHSSPYLANWGRPESWGTGDSHNWGVWYGKK
PFESLDTDLPRFMSEFGFQSFPEMKTIAAFAAPEDYQIESEVMNAHQKSSIGNSLIRTYM
ERDYIIPESFEDFVYVGLVLQGQGMRHGLEAHRRNRPYCMGTLYWQLNDSWPVVSWSSID
YYGNWKALHYQAKRAFAPVLINPIQQNDSLSVYLISDRLDTMEQMTLEMKVVDFDGKTLG
KKIQVHSLEVPANTSKCVYRAKLDGWLTPEDCRRSFLKLILKDKSGHQVAESVHFFRKTK
DLQLPPTSVSYQMKQTDGKCELTLFSSMLAKDIFIETPLQGARYSDNFFDLLPGERKKVI
ITSPRIKKGEELPVNIKHIRETYK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM36385
n/a
NameBDBM36385
Synonyms:(3S,4R,5R)-3,4-Dihydroxy-5-(hydroxymethyl)piperidin-2-one, 6 | CID448980
TypeSmall organic molecule
Emp. Form.C6H11NO4
Mol. Mass.161.1558
SMILESOC[C@H]1CNC(=O)[C@@H](O)[C@@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: