Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDihydrofolate Reductase-Thymidylate Synthase (DHFR-TS)
LigandBDBM18789
Substrate/CompetitorBDBM18044
Meas. Tech.Inhibitor Screening Using Bacterial System (IC50) and Measurement of Inhibition Constant (Ki)
pH7±n/a
Temperature298.15±n/a K
Ki 4.18±0.29 nM
IC50 11330±3330 nM
Citation Bunyarataphan SLeartsakulpanich UTaweechai STarnchompoo BKamchonwongpaisan SYuthavong Y Evaluation of the activities of pyrimethamine analogs against Plasmodium vivax and Plasmodium falciparum dihydrofolate reductase-thymidylate synthase using in vitro enzyme inhibition and bacterial complementation assays. Antimicrob Agents Chemother 50:3631-7 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Dihydrofolate Reductase-Thymidylate Synthase (DHFR-TS)
Name:Dihydrofolate Reductase-Thymidylate Synthase (DHFR-TS)
Synonyms:PvDHFR-TS
Type:Enzyme
Mol. Mass.:71083.97
Organism:Plasmodium vivax (malaria parasite P. vivax)
Description:O02604
Residue:623
Sequence:
MEDLSDVFDIYAICACCKVAPTSEGTKNEPFSPRTFRGLGNKGTLPWKCNSVDMKYFSSV
TTYVDESKYEKLKWKRERYLRMEASQGGGDNTSGGDNTHGGDNADKLQNVVVMGRSSWES
IPKQYKPLPNRINVVLSKTLTKEDVKEKVFIIDSIDDLLLLLKKLKYYKCFIIGGAQVYR
ECLSRNLIKQIYFTRINGAYPCDVFFPEFDESQFRVTSVSEVYNSKGTTLDFLVYSKVGG
GVDGGASNGSTATALRRTAMRSTAMRRNVAPRTAAPPMGPHSRANGERAPPRARARRTTP
RQRKTTSCTSALTTKWGRKTRSTCKILKFTTASRLMQHPEYQYLGIIYDIIMNGNKQGDR
TGVGVMSNFGYMMKFNLSEYFPLLTTKKLFLRGIIEELLWFIRGETNGNTLLNKNVRIWE
ANGTREFLDNRKLFHREVNDLGPIYGFQWRHFGAEYTNMHDNYEDKGVDQLKNVIHLIKN
EPTSRRIILCAWNVKDLDQMALPPCHILCQFYVFDGKLSCIMYQRSCDLGLGVPFNIASY
SIFTHMIAQVCNLQPAQFIHILGNAHVYNNHVDSLKVQLNRIPYPFPTLKLNPEVKNIED
FTISDFTIENYVHHDKITMEMAA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM18789
BDBM18044
NameBDBM18789
Synonyms:6-methyl-5-phenylpyrimidine-2,4-diamine | CHEMBL21408 | P36
TypeSmall organic molecule
Emp. Form.C11H12N4
Mol. Mass.200.2398
SMILESCc1nc(N)nc(N)c1-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: