Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein-Tyrosine Phosphatase 1B (PTP1B)
LigandBDBM13952
Substrate/CompetitorBDBM13466
Meas. Tech.PTP1B and TCPTP Inhibition Assay
pH7.5±n/a
Temperature295.15±n/a K
Ki 39000±14000 nM
Citation Szczepankiewicz BGLiu GHajduk PJAbad-Zapatero CPei ZXin ZLubben THTrevillyan JMStashko MABallaron SJLiang HHuang FHutchins CWFesik SWJirousek MR Discovery of a potent, selective protein tyrosine phosphatase 1B inhibitor using a linked-fragment strategy. J Am Chem Soc 125:4087-96 (2003) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Protein-Tyrosine Phosphatase 1B (PTP1B)
Name:Protein-Tyrosine Phosphatase 1B (PTP1B)
Synonyms:PTP-1B | PTPase 1B | Tyrosine-protein phosphatase, non-receptor type 1
Type:Enzyme
Mol. Mass.:34670.65
Organism:Homo sapiens (human)
Description:The catalytic domain of PTP 1B (residues 1-298) was expressed and purified from E. coli.
Residue:298
Sequence:
MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLH
QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLK
CAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWP
DFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD
PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM13952
NameBDBM13952
Synonyms:2-(Naphthalen-1-yloxalylamino)benzoic Acid | 2-(naphthalen-1-ylamidoformic acid)benzoic acid | CHEMBL64934 | naphthyloxamic acid 5
TypeSmall organic molecule
Emp. Form.C19H13NO5
Mol. Mass.335.3102
SMILESOC(=O)C(=O)N(c1ccccc1C(O)=O)c1cccc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM13466
NameBDBM13466
Synonyms:4-Nitrophenyl phosphate disodium salt hexahydrate | 4-nitrophenyl phosphate (pNPP) | disodium (4-nitrophenyl) phosphate | para-nitrophenyl phosphate (pNPP)
TypeSmall organic molecule
Emp. Form.C6H4NO6P
Mol. Mass.217.0739
SMILES[O-][N+](=O)c1ccc(O[P+]([O-])([O-])[O-])cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: