Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein farnesyltransferase
LigandBDBM13307
Substrate/Competitorbiotinylated lamin B peptide substrate
Meas. Tech.PFT IC50 Determination
pH7.5±n/a
Temperature310.15±n/a K
IC50 25±n/a nM
Citation Glenn MPChang SYHorney CRivas KYokoyama KPusateri EEFletcher SCummings CGBuckner FSPendyala PRChakrabarti DSebti SMGelb MVan Voorhis WCHamilton AD Structurally simple, potent, Plasmodium selective farnesyltransferase inhibitors that arrest the growth of malaria parasites. J Med Chem 49:5710-27 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Protein farnesyltransferase
Name:Protein farnesyltransferase
Synonyms:CAAX farnesyltransferase alpha subunit | FTase-alpha | GGTase-I-alpha | Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit | Ras proteins prenyltransferase alpha | Type I protein geranyl-geranyltransferase alpha subunit
Type:Enzyme
Mol. Mass.:44030.14
Organism:Rattus norvegicus (rat)
Description:Recombinant rat enzyme.
Residue:377
Sequence:
MAATEGVGESAPGGEPGQPEQPPPPPPPPPAQQPQEEEMAAEAGEAAASPMDDGFLSLDS
PTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLT
RDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLK
DPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQR
HFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLL
DLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIG
RSLQSKHSRESDIPASV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM13307
biotinylated lamin B peptide substrate
Name:biotinylated lamin B peptide substrate
Synonyms:n/a
Type:Peptide
Mol. Mass.:1715.01
Organism:n/a
Description:A human lamin-B carboxy-terminus sequence peptide (biotin-YRASNRSCAIM) is 3H-farnesylated at the cysteine residue when processed by farnesyltransferase.
Residue:15
Sequence:
biotin-YRASNRSCAIM