Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein Farnesyltransferase (PFT)
LigandBDBM13307
Substrate/Competitorbiotinylated lamin B peptide substrate
Meas. Tech.PFT IC50 Determination
pH7.5±n/a
Temperature310.15±n/a K
IC50 0.5±n/a nM
Citation Glenn MPChang SYHorney CRivas KYokoyama KPusateri EEFletcher SCummings CGBuckner FSPendyala PRChakrabarti DSebti SMGelb MVan Voorhis WCHamilton AD Structurally simple, potent, Plasmodium selective farnesyltransferase inhibitors that arrest the growth of malaria parasites. J Med Chem 49:5710-27 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Protein Farnesyltransferase (PFT)
Name:Protein Farnesyltransferase (PFT)
Synonyms:Protein prenyltransferase, alpha subunit
Type:Enzyme
Mol. Mass.:54781.31
Organism:Plasmodium falciparum (malaria parasite P. falciparum)
Description:Q5E175
Residue:500
Sequence:
MGFTSLGLSAPILKAVEEQGYSTPSPIQLQAIPAVIEGKDVMAAAQTGTGKTAGFTLPLL
ERLSNGPKRKFNQVRALVLTPTRELAAQVHESVEKYSKNLPLTSDVVFGGVKVNPQMQRL
RRGVDVLVATPGRLLDLANQNAIKFDQLEILVLDEADRMLDMGFIHDIKKILAKLPKNRQ
NLLFSATFSDEIRQLAKGLVKDPVEISVAKRNTTAETVEQSVYVMDKGRKPKVLTKLIKD
NDWKQVLVFSKTKHGANRLAKTLEEKGVSAAAIHGNKSQGARTKALANFKSGQVRVLVAT
DIAARGLDIEQLPQVINVDLPKVPEDYVHRIGRTGRAGATGKAISFVSEDEAKELFAIER
LIQKVLPRHVLEGFEPVNKVPESKLDTRPIKPKKPKKPKAPRVEHKDGQRSGENRNGNKQ
GAKQGQKPATKRTPTNNPSGKKEGTDSDKKKRPFSGKPKTKGTGENRGNGSNFGKSKSTP
KSDVKPRRQGPRPARKPKAN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM13307
NameBDBM13307
Synonyms:1-Methyl-1H-imidazole-4-sulfonic Acid Benzyl-{2-[(4-cyanophenyl)-(3-methyl-3H-imidazol-4-ylmethyl)amino]ethyl}amide | Chem Biol Compound 2 | N-benzyl-N-{2-[(4-cyanophenyl)[(1-methyl-1H-imidazol-5-yl)methyl]amino]ethyl}-1-methyl-1H-imidazole-4-sulfonamide | Sulfonamide 12d
TypeSmall organic molecule
Emp. Form.C25H27N7O2S
Mol. Mass.489.593
SMILESCn1cnc(c1)S(=O)(=O)N(CCN(Cc1cncn1C)c1ccc(cc1)C#N)Cc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
biotinylated lamin B peptide substrate
Name:biotinylated lamin B peptide substrate
Synonyms:n/a
Type:Peptide
Mol. Mass.:1715.01
Organism:n/a
Description:A human lamin-B carboxy-terminus sequence peptide (biotin-YRASNRSCAIM) is 3H-farnesylated at the cysteine residue when processed by farnesyltransferase.
Residue:15
Sequence:
biotin-YRASNRSCAIM