BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Reverse transcriptase (HIV-1 RT)(1-350)
Syringe Reactant:BDBM2337
Meas. Tech.:Enzyme Inhibition
Entry Date:06/16/17
 
ΔG°:-145±44.8 (kJ/mole)
pH:n/a
Log10Kb:n/a
Temperature:298.15±0 (K)
ΔH° :-230± (kJ/mole)
ΔHobs:n/a
Ionic Strength:n/a
Corrected for ΔHioniz:n/a
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° : -0.0678±0.0345 (kJ/mole-K)
Comments:n/a
 
Citation Decha PIntharathep PUdommaneethanakit TSompornpisut PHannongbua SWolschann PParasuk V Theoretical studies on the molecular basis of HIV-1RT/NNRTIs interactions. J Enzyme Inhib Med Chem 26:29-36 (2011) [PubMed]
More Info.:  Get all data from this article ,  ITC RUN data
 
Reverse transcriptase (HIV-1 RT)(1-350)
Source:n/a
Purity:n/a
Prep. Method:n/a
Name:Reverse transcriptase (HIV-1 RT)(1-350)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:39217.95
Organism:Human immunodeficiency virus type 1
Description:HIV-1 RT variant (1-350 aa)
Residue:350
Sequence:
MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFAVNPGLLETSEGCRQI
LGQLQPSLQTGSEELRSLYNTVATLYCVHQRIEIKDTKEALDKIEEEQNKSKKKAQQAAA
DTGHSNQVSQNYPIVQNIQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGAT
PQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTT
STLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRF
YKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTAC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM2337
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM2337
Synonyms:6-benzyl-1-(ethoxymethyl)-5-(propan-2-yl)-1,2,3,4-tetrahydropyrimidine-2,4-dione | CHEMBL35033 | Coactinon | Emivirine | Emivirine (EMV) | HEPT deriv. | I-EBU | MKC-442
TypeSmall organic molecule
Emp. Form.C17H22N2O3
Mol. Mass.302.3682
SMILESCCOCn1c(Cc2ccccc2)c(C(C)C)c(=O)[nH]c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.