BindingDB logo
myBDB logout

BindingDB Data by Sequence


Search BindingDB

   Help

This search will return sequences of biomolecules in BindingDB that are similar to your sequence of interest. Paste your protein or DNA search sequence into the textbox above, choose the appropriate desired search program from the pull-down menu above, and click the 'Search' button. Here are two protein sequences and one DNA sequence you can use to try this feature:
Antibody: DIVLTQSPAS LSASVGETVT ITCRASGNIH NYLAWYQQKQ GKSPQLLVYY TTTLADGVPS RFSGSGSGTQ YSLK
HIV-1 Protease: PQVTLWQRPL VTIKIGGQLK EALLDTGADD TVLEEMSLPG RWKPKMIGGI GGFIKVRQYD QILIEIXGHK
DNA(calf thymus): GATCCAGACC CCTTTCCGGG CACGTCTGCT CTCCAGCCCA GCCCCTACCT GGAAACCCCC TCCCGCGCCC

Sequence NameSource OrganismEnz. Inhib. DataITC DataSequence
Ki
Data
IC50
Data
Kd
Data
EC50
Data
Koff
Data
Kon
Data
other
α-galactosidaseBDBCoffea arabica (Coffee beans)530000000MVKSPGTEDYTRRSLLANGLGLTPPMGWNSWNHFRCNLDEKLIRETADAMVSKGLAALGYKYINLDDCWAELNRDSQGNLVPKGSTFPSGIKALADYVHSKGLKLGIYSDAGTQTCSKTMPGSLGHEEQDAKTFASWGVDYLKYDNCNNNNISPKERYPIMSKALLNSGRSIFFSLCEWGEEDPATWAKEVGNSWRTTGDIDDSWSSMTSRADMNDKWASYAGPGGWNDPDMLEVGNGGMTTTEYRSHFSIWALAKAPLLIGCDIRSMDGATFQLLSNAEVIAVNQDKLGVQGNKVKTYGDLEVWAGPLSGKRVAVALWNRGSSTATITAYWSDVGLPSTAVVNARDLWAHSTEKSVKGQISAAVDAHDSKMYVLTPQ
α-glucosidaseBDBSaccharomyces cerevisiae S288c (Baker's yeast)7328000000MTISSAHPETEPKWWKEATFYQIYPASFKDSNDDGWGDMKGIASKLEYIKELGADAIWISPFYDSPQDDMGYDIANYEKVWPTYGTNEDCFALIEKTHKLGMKFITDLVINHCSSEHEWFKESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWKSYFGGSAWTFDEKTQEFYLRLFCSTQPDLNWENEDCRKAIYESAVGYWLDHGVDGFRIDVGSLYSKVVGLPDAPVVDKNSTWQSSDPYTLNGPRIHEFHQEMNQFIRNRVKDGREIMTVGEMQHASDETKRLYTSASRHELSELFNFSHTDVGTSPLFRYNLVPFELKDWKIALAELFRYINGTDCWSTIYLENHDQPRSITRFGDDSPKNRVISGKLLSVLLSALTGTLYVYQGQELGQINFKNWPVEKYEDVEIRNNYNAIKEEHGENSEEMKKFLEAIALISRDHARTPMQWSREEPNAGFSGPSAKPWFYLNDSFREGINVEDEIKDPNSVLNFWKEALKFRKAHKDITVYGYDFEFIDLDNKKLFSFTKKYNNKTLFAALNFSSDATDFKIPNDDSSFKLEFGNYPKKEVDASSRTLKPWEGRIYISE
α7β2 nAChR
Neuronal acetylcholine receptor protein alpha-2/beta-2 subunit
Neuronal acetylcholine receptor protein alpha-3/beta-2 subunit
Neuronal acetylcholine receptor protein alpha-4/beta-2 subunit
Neuronal acetylcholine receptor protein beta-2 subunit/protein beta-3 subunit/subunit alpha-3/subunit alpha-6
Nicotinic acetylcholine receptor alpha2/beta2
Nicotinic acetylcholine receptor alpha4/beta2/alpha5BDB
HUMAN
Homo sapiens
Homo sapiens (Human)
Homo sapiens (human)
676414